DPCstruct | MC57923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661S3G5 | 2-72 | FYHLTRMAHMSHACVGCGQCSNACPSDINVFELFKSVAHDTQAAFEYSPGTDENEPPPLSVFYEKEFEEIV |
| A0A842W3R4 | 1-84 | MYLKEQRKEKTIDKITYQLTRISHVGDACVGCGKCDMNCPTNLPLSFYFQSLNDMVRDDFGYIPGCDESATPPRSKKAVEDLAE |
| A0A352Z7K9 | 136-215 | None |
| A0A812A4F8 | 83-159 | None |
| A0A662RM65 | 87-162 | None |
| A0A832QT13 | 30-96 | None |
| A0A847EHE4 | 109-183 | None |
| A0A7C0YF77 | 1-70 | None |
| A0A7C1BMI4 | 96-169 | None |
| A0A524FNE7 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.