DPCstruct | MC5792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0L8G1 | 1-134 | MGTFHTGYCPNVPELHIKFDEAFKLVNVSGEQYEQILQVVRHHTEDTSYLLNKMKERFGWVSELSNMTIGPENIFNIVKVVPGDPSS… |
| A0A1B8XWS7 | 17-145 | SGKDPVQEQLQEVFQDSLRLAERFTREYDDLLEQFREKMLNTTGILEQLNKQFGWLSKFTNMTQGRKNGIFQVSTIYSKEGESPSDT… |
| A0A6B0RWJ0 | 351-490 | None |
| A0A6I9MRR1 | 26-166 | None |
| F1MWI1 | 236-382 | None |
| A0A5E4CDM4 | 140-292 | None |
| A0A1V4JDT8 | 43-193 | None |
| A0A4W2GR74 | 285-429 | None |
| A0A7J7X9C7 | 232-364 | None |
| A0A7J7TZH7 | 88-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.