DPCstruct | MC57907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 232 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812LA69 | 185-392 | MIPLLSYSFQHKLYVDIARLLVFAFQRCLMTLNEASVWGHTLQVTSKGYLARHLPTLQSSKVGSAQLEAVVDMMLQTQRFHLPWLPR… |
| A0A812Z043 | 46-260 | YVDLVLADPRSQVNDPAVPDFIEREVYFVVVRFVLQMVHYAFGIVDQRALFGQTLYMLQYPEKQSSGLHRSDVELTPEMINFFMREV… |
| A0A7S2CT92 | 14-235 | None |
| A0A7S1D3I5 | 2-216 | None |
| A0A7S4QWR4 | 75-317 | None |
| A0A7S0H4R8 | 377-617 | None |
| A0A7S3JX59 | 150-417 | None |
| A0A7S0ZYB4 | 169-426 | None |
| A0A7S0WQA9 | 65-309 | None |
| A0A7J6NV24 | 263-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.