DPCstruct | MC57906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 311 ± 60 aa |
| Standard deviation of domain lengths | 60.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812YUF7 | 60-311 | LFAALVSGLGVAGLEADRLRSVAAMRQSEELARGFAGSVRRAQSSDANDLRMIMGEIEEHGQADDIDDMVGALMTSNVSTRRMRLVI… |
| A0A7S2HX37 | 282-528 | WMRNDHFSFVEEADAIRMRATLLAGVCYFVIAEVDTMRSTLAYAESCQLRQGYSGSIMDASCAVQRDADYILREIGGKAGEVDHAIQ… |
| A0A7S2KA52 | 1-225 | None |
| A0A7S2L815 | 82-336 | None |
| A0A7S2LDZ5 | 2-268 | None |
| A0A812G662 | 170-582 | None |
| A0A812JTB9 | 439-809 | None |
| A0A812ZPA6 | 98-352 | None |
| A0A812P2L2 | 92-460 | None |
| A0A812N424 | 591-863 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.