DPCstruct | MC57903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 364 ± 48 aa |
| Standard deviation of domain lengths | 47.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DEM2 | 7-293 | DALKQEILSTNQFLENMRSMPNFQCILDVQARALVARIVKMGGIPAEAAASVAEVWNQGPWSETHRTDFGQALSTAVATGGGRRKGQ… |
| A0A812Y1D8 | 1-430 | MAAVCKQLEAAQRFLRQVCKLPSFESLREKQLTVVLSVLKKTKVLSLKDANSILQMLESDIWSEDLSQQVREAVSGLLVVEAADQGE… |
| A0A1Q9D4Q7 | 275-684 | None |
| A0A1Q9D760 | 2-361 | None |
| A0A812I255 | 462-873 | None |
| A0A812J209 | 20-427 | None |
| A0A812JBW4 | 15-362 | None |
| A0A812S0A9 | 1-342 | None |
| A0A812UY78 | 277-635 | None |
| A0A812IEJ3 | 11-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.