DPCstruct | MC579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 386 ± 30 aa |
| Standard deviation of domain lengths | 30.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1SC54 | 180-555 | VSEISADGFVLLAANAQRDIYTLDFGDSGWTRRWGPLFWLDMGVTIPPDVTHWAASELHSGFDDYFVDIAGRKNDFWGILMLYMLRG… |
| A0A5P2D914 | 11-393 | ITGISVDDDELAAVDDGGRIYTMDHALNAPWTWNWTHRYGTPLWLGDGNTVPYGSARWTWSVLSPGEDRVWRDTAGNDHPVGGAKVS… |
| A0A817MIV2 | 1-347 | None |
| A0A496XNN6 | 131-564 | None |
| A0A815LR14 | 12-366 | None |
| E1R744 | 143-555 | None |
| A0A2N2JPR7 | 107-525 | None |
| A0A2W5T201 | 25-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.