DPCstruct | MC57898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 199 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.34 |
| Pfam Score | 34.55 |
| Assigned Pfam label(s) | PF07589- PF08341- PF20610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839YUA3 | 287-467 | IEASLPQGGLFKVTLDTAGSAFYDLTITGTGDARLDGLTIDAAYCAAAHEPFDIGQTIAFEMYLADADSIPAGTVQRPEHLDEVNWI… |
| A0A3R9WE89 | 15-202 | LFSGSAKADTLKMVGAATGQTGPYQLQLDGTTPVSLFCLDDQREVQVGESWQVNIVNGDAYLNSSKSSTGFKYEEEAYIYSMLGVSN… |
| A0A7C3AQ76 | 22-190 | None |
| A0A8A9I6H4 | 9-235 | None |
| A0A1I3EKW5 | 454-636 | None |
| A0A4R7FYG9 | 15-214 | None |
| F8UNK3 | 8-169 | None |
| A0A661A789 | 45-227 | None |
| A0A7Y8LXU7 | 1-158 | None |
| A0A6M1SXE4 | 21-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.