DPCstruct | MC57890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 341 |
|---|---|
| Mean domain length (aa) | 261 ± 67 aa |
| Standard deviation of domain lengths | 66.66 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.73 |
| Pfam Score | 98.73 |
| Assigned Pfam label(s) | CL0041- CL0016- CL0197- PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9KC11 | 13-239 | AALRAEGVEVIAAEPLGGRYTKSVYVRDPLVTVPGGAIVLRMAVRMRRGEEADITRTVAALGLPILATLTGTATAEGGSFVKLGPGV… |
| A0A4U9U819 | 25-321 | SGSDESVLAQAMRTSPRLLSALSSASSMWTANAATVSPSPDSLDGKVHFTAANLNNKFHRAIEAETTSSVLRAIFNDEQYFTHHDAL… |
| A0A146HR64 | 194-419 | None |
| A0A2G9N5M8 | 2-210 | None |
| A0A2V7S1V6 | 158-393 | None |
| A0A1M7A2M9 | 27-334 | None |
| A0A517NTI3 | 354-663 | None |
| A0A7R9A5D3 | 837-1058 | None |
| A0A7R8WZM6 | 9-215 | None |
| A0A1C9VEB1 | 24-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.