DPCstruct | MC5789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 157 ± 27 aa |
| Standard deviation of domain lengths | 26.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7NNP1 | 159-379 | PMARLSGGCKKVIFNVFRKCSKENLDHLFYHCVQGMITESSKGMSVIGYKVFLQMLAHYKPNIVLQRLPQYLELLKTSQNRPAQCLS… |
| A0A1B8XSG5 | 1-144 | MVDHCIFSMLQELDKPTGESLHGYRICIQAVLLDKPKTVTSNLPKYLELLRSHLNRPMKCLTVMWAVGQAGFTDLAEGLKVWLGLMF… |
| A0A5B7FC75 | 89-241 | None |
| A0A663N8F0 | 147-288 | None |
| A0A2A4J9V0 | 178-331 | None |
| A0A6P7HA53 | 124-259 | None |
| A0A7J7JV44 | 183-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.