DPCstruct | MC57885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0RQ11 | 20-135 | QTKASFAKTLEQVLEMQPGRLSVFNYAHMPQLFAAQRKIKDEDLPKAEEKMAILQDTIATLTGAGYQFIGMDHFAMPDDELAVAQRE… |
| A0A448MTV9 | 1-120 | MIELNPDRLSIFNYAHLPSRVPGQAKIKEEQLPKPETKLTILQKTIETLGDAGYKFIGMDHFAKPYDELAIAQEKGVLHRNFQGYTT… |
| A0A484Y7T6 | 1-83 | None |
| A0A7C1AEU0 | 1-81 | None |
| H1WHB3 | 1-87 | None |
| A0A2G6CCA3 | 1-98 | None |
| A0A538TNL0 | 997-1111 | None |
| A0A657AKP0 | 1-98 | None |
| A0A7J6Z8X1 | 191-307 | None |
| A0A136PA94 | 218-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.