DPCstruct | MC57884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 28 aa |
| Standard deviation of domain lengths | 28.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.94 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0036- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J0QU54 | 1-111 | MGEALYKEVVGQDKLARPACIYAPVGTHETLLAYLVRRLLENGANASFANRIGDPNVSIMDLIEDTVDHARALVDRGASHSEILLPE… |
| A0A448MRS6 | 2-140 | LIRYGESLYDNIVGNENFNQQVRVYTPVGTHETLLAYLVRRLLENGANSSFVHQLVDESIPVSQLVTPPWKLYNKSNGEPNKLVRKP… |
| A0A7V3BJ36 | 38-175 | None |
| A0A376RKT6 | 34-221 | None |
| A0A2A2HFY8 | 262-390 | None |
| A0A1X1QV72 | 64-169 | None |
| A0A4U9HPX9 | 228-412 | None |
| A0A485ABR5 | 168-275 | None |
| A0A380APJ3 | 18-187 | None |
| A0A0U3A1Z8 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.