DPCstruct | MC57882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 202 |
|---|---|
| Mean domain length (aa) | 196 ± 38 aa |
| Standard deviation of domain lengths | 38.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 70.80 |
| Assigned Pfam label(s) | CL0030- CL0235- PF00773- CL0306- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448MQP1 | 41-222 | DYLELRLRRYLTFAEFKAELSPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLTQQPCEKPQDDVLARLQEARRQNRLVERDIADW… |
| A0A379D2N0 | 29-209 | FLDSRIRRFQSFAEISVEPGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAIIKGESPARPQDDITVQMAERRRANRMAERDVADWL… |
| A0A2T7P6D4 | 73-336 | None |
| S7WLJ5 | 230-423 | None |
| A0A812Q5J2 | 511-776 | None |
| A0A645C9G7 | 13-188 | None |
| S4RFV9 | 2-132 | None |
| A0A7S1FAN5 | 147-388 | None |
| A0A836QU29 | 111-257 | None |
| A0A1I8I1G4 | 170-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.