DPCstruct | MC5788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 144 ± 29 aa |
| Standard deviation of domain lengths | 29.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1DJW2 | 8-135 | DQAVFHRLLSLHEHIQRDLELRPDGIRARTRSDDPEVVALLHDHVPAMKQRLHENFGLRFWDPAFAELFAQQGKVEMEVSLLPDGVM… |
| A0A518GTD1 | 249-380 | GPGPEMRADQDVFHFLLDHHKEIRRSVKRLDNGVETLTESDNKEVATKIQEHVASMHQRIKDGRGLRFWDELFVAIFQKHASIKMTV… |
| A0A3L7PS37 | 2-111 | None |
| A0A7V2T168 | 29-190 | None |
| A0A517U4U2 | 233-390 | None |
| A0A2V7YAL5 | 12-160 | None |
| A0A7V3F734 | 1-152 | None |
| A0A6I1JT45 | 20-170 | None |
| A0A7W9W9N7 | 9-173 | None |
| A0A5C5XG95 | 234-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.