DPCstruct | MC57878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448MJA9 | 1-121 | MEDITVQSPNILIDTSKLPPSEPRQAENNEMEKVNLPVSLDVKNVTVEDLNLQLDQTYIALEHFQSAVSLNNESGLTLASTEFNKLN… |
| A0A656SIK0 | 2-114 | CVDELALQGVNFQMPELPPASEEPEEETPPLRSISTPVPIFVNKVSFNDINVNVLGNQIDWQTFSTALSMQGDRLVIAPTALKDINV… |
| A0A4Q0YQL3 | 93-201 | None |
| A0A6C9Y0A1 | 3-132 | None |
| A0A376U316 | 52-189 | None |
| A0A077ZFV6 | 635-764 | None |
| A0A090RHB8 | 54-150 | None |
| A0A3T1DRN7 | 41-183 | None |
| A0A2X3GWL5 | 33-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.