DPCstruct | MC5787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R9ELG3 | 25-94 | ATAEPGFKPFWFAVPVARPLMSDKGALEVVGELVPGTWYLAVERRGQGFLPMTPGGLYGFLLDTSGIQRG |
| A0A7Y6A5M8 | 9-78 | ATAGEDFAQFWLAVPEERPLLPLGGLDKTPVATLTPGNWYLAVEPAGDGLVVEVEGTRGVLWNTSGIQRG |
| A0A2T3BZB1 | 493-558 | None |
| A0A0L0L4N8 | 1-68 | None |
| A0A7W9CQ17 | 270-338 | None |
| A0A496PLD2 | 209-274 | None |
| A0A2T7TJR8 | 134-205 | None |
| A0A0T1QB79 | 296-369 | None |
| A0A1H5DJJ2 | 1-57 | None |
| A0A2A9DYP9 | 372-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.