DPCstruct | MC57860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4GWL0 | 171-298 | DVARGGIRIVMSRNKEMYSINQRMLFDENYNLASTQSLKNKDIPEGGAKGTILPSIGATPRLCFEKYVDAIVDLLIPGKTPGIKETL… |
| A0A0L0NW60 | 61-189 | GGIRVVRSRSVDAYNVNVRNLFDENYNLAATQQKKNKDIPEGGSKGVILLDPGLAQETPKASFEKYIDALIDLLLKQHIPGAKEPFV… |
| A0A6A4GKX9 | 574-684 | None |
| C9SP25 | 283-414 | None |
| A0A6A4GYT7 | 365-473 | None |
| A0A6A4GUX0 | 253-360 | None |
| A0A6A4GUS3 | 19-148 | None |
| A0A0C3PFA9 | 558-688 | None |
| A0A1J5WKA9 | 381-508 | None |
| A0A6G0MKD4 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.