DPCstruct | MC57848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3E3H7 | 109-198 | SGVTDDLQGVFLMLAKAAVCGEPCPSDARIARAYGTHSARRARRLLGYFEEQGIIVVHADFSGKRIVAIPDMDCQTAPGDANAPDTG… |
| A0A7U8KTD1 | 4-82 | VFLIVAQAAVTGAPCPSDAALARAYGTHSFSRARRLLAYFEERGLLVVRNDFKGMRIVNFPDLGCETAPGDPNAPDDQA |
| A0A0A6D0D7 | 6-113 | None |
| A0A7W9EDU1 | 87-182 | None |
| A0A2G4IIF0 | 4-104 | None |
| A0A6I4TXC9 | 38-117 | None |
| A0A558R878 | 6-94 | None |
| A0A1E2RZX1 | 31-116 | None |
| A0A158RYT3 | 98-183 | None |
| A0A2W5KSS6 | 95-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.