DPCstruct | MC57841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 360 ± 84 aa |
| Standard deviation of domain lengths | 84.16 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.05 |
| Pfam Score | 92.55 |
| Assigned Pfam label(s) | CL0340- PF00367- CL0031- CL0166- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8NS20 | 20-407 | PMKKRHRFNQVMSEIINPIIPAFIGAGLLGGVGNLISSFGPDNPSTVAWSNFFSLLLNLLTSLFIILIGWNAGKKFGTQAAITALIA… |
| A0A0R1N7I5 | 69-345 | GSQGLFTAMIVGGVAGAIFIFLMKKDLTIKMPDGVPPAVTQAFAAIIPATAAFYVVGIFTWAFTKLTSMAFVDWVAKAIQEPLLHAS… |
| A0A316RUQ0 | 367-688 | None |
| A0A0U3NQ23 | 15-473 | None |
| A0A1X7ARM8 | 222-581 | None |
| A0A084U356 | 12-425 | None |
| A0A857DBG6 | 129-386 | None |
| A0A6L5XQN9 | 3-448 | None |
| A0A5D4IV00 | 73-443 | None |
| A0A100JAP6 | 9-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.