DPCstruct | MC57838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 23.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.24 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | PF16548- CL0319 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5F8V5 | 11-138 | FFILLQTTYANQCESDSFREENICIIAGGAADTTKTLNLAHARSLSLRNARIIAYEKMAERLEGVIIGAQTTQSGDLISDGQVKTIV… |
| A0A7C4IER4 | 288-390 | QLPAAAPEWARMPLDASGEAAAAETKLRAAMQAEQRAREALRRQVEALRLNGLTVGQAAEKDGSIARGMSRAIEEAKATRTEYRPDG… |
| A0A3C1ERN4 | 7-164 | None |
| A0A3B9YF70 | 19-207 | None |
| A0A3M1FQW5 | 18-195 | None |
| A0A316GZ08 | 61-168 | None |
| A0A351RSS1 | 15-119 | None |
| E4TH67 | 5-135 | None |
| A0A3M1B7J7 | 17-205 | None |
| A0A258TNH7 | 20-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.