DPCstruct | MC57836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 268 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 11.45 |
| Pfam Score | 17.86 |
| Assigned Pfam label(s) | PF15594- CL0057- PF13315- PF11164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D6ZRB0 | 9-110 | EILSDYGYWPSFHDDYIIKFTIDGSSIDMIIRMESIPKGYNEYSVLFTFEEVNDFELKGELLGTASIIFDLEFKKSDFLVCTINSSM… |
| R5WN15 | 1-132 | MWYEISSERDINDFMKKINFFHDCCIKELKYSSGAYVNNRYEMYPVNDKRILNVAFQCQSEENGMFELEFQGLKYLKLLPLDETYTC… |
| A0A1G5IUG1 | 131-248 | None |
| A0A501XWX0 | 4-87 | None |
| A0A1H6WSG3 | 9-131 | None |
| A0A7U6KH32 | 8-141 | None |
| J4TK27 | 14-145 | None |
| A0A1M5J7N0 | 20-122 | None |
| A0A4S8P1H7 | 11-127 | None |
| A0A7Y4ZSQ4 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.