DPCstruct | MC5783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 50 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 37.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7URQ1 | 326-373 | APQWQPYVAYKAGDFVSYEDKIYSIIQPHTSQINWNPTATPALWRNEI |
| A0A7Y5XDQ5 | 143-195 | TATGSYPAWVANHAYAAGDLVTYGGHTYKCLQPHTSLVGWEPPNVPALWQLIS |
| A0A7Z0Q2K8 | 323-378 | None |
| A0A4R2K415 | 209-258 | None |
| A0A1W1XWG1 | 15-70 | None |
| A0A1W1X910 | 32-77 | None |
| A0A6G0ZWA6 | 26-73 | None |
| A0A0D2YFT4 | 149-194 | None |
| S0FIB6 | 231-280 | None |
| A0A3D5UM90 | 4-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.