DPCstruct | MC57828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 158 ± 32 aa |
| Standard deviation of domain lengths | 31.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C2IDG3 | 4-120 | GDRLVRLERHQAENFLVQSIWALIPITPVEDLLVLGFNREVVEHAWEFLPEAVLPTFRKKRNYISAILARNEVQRDYAYNRHLFLRV… |
| A0A080M198 | 118-270 | EALLERGANREAVDHYGYNALHWALREAFRDARFAGGPLAALYELLAPASIDVNTGDRLVRIDRHLSEYFIFQTLWVLFKSRFTHWQ… |
| A0A257STG1 | 24-169 | None |
| A0A7W1SP08 | 51-188 | None |
| F5NVN5 | 30-223 | None |
| A0A7C2C3E7 | 12-205 | None |
| A0A1M3MVI5 | 259-445 | None |
| A0A845U7Y9 | 19-231 | None |
| A0A1G0M746 | 3-122 | None |
| A0A847VER5 | 2-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.