DPCstruct | MC57823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 511 ± 140 aa |
| Standard deviation of domain lengths | 139.61 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.58 |
| Pfam Score | 81.86 |
| Assigned Pfam label(s) | CL0014- PF02769- PF18072- PF00586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4FKK0 | 63-598 | IMLAGGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGLGGGAASSMASGQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPI… |
| A0A0B0NPK1 | 28-553 | PWEDSSFTYPSNLASPLEILIEVSNGASDYGNKFGEPLIQGFTRTFGMRLPSGERREWLKPIMFSGGIGQIDHTHISKGDPEIGMLV… |
| A0A7C7REU5 | 377-767 | None |
| V9GLD2 | 2-326 | None |
| A0A538B283 | 247-593 | None |
| A0A803LBM8 | 392-952 | None |
| A0A3A9STN1 | 181-974 | None |
| K6QFC0 | 159-919 | None |
| A0A4R2EMW5 | 35-626 | None |
| A0A7K0BUN8 | 318-976 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.