DPCstruct | MC57820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1R061 | 1-85 | MTKFNLEQALQGAPVRLNNGFKAYIFADVSLLAINEPYPLIGGYAYSISSFYDNQEHQRFEECRWAKDGKCDRLSALGSIAGMWE |
| A5UGP2 | 1-84 | MKEFNLDAALNGEPVKLRNGLKAIVYYRIPDEFSYPGGSTEIYPLLGIIFNKDGTIKGASENWKDCGAYCSCQGGLDIVGMWEE |
| A0A379B654 | 1-76 | None |
| A0A7H1BZW2 | 1-82 | None |
| A0A502JQN5 | 1-72 | None |
| U4SKK2 | 79-160 | None |
| A0A5D0EMA5 | 69-140 | None |
| A0A380XA39 | 1-78 | None |
| A0A380X3T6 | 1-72 | None |
| A0A0E3ZMM1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.