DPCstruct | MC5782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538CXK9 | 218-312 | TNFYWGCEADDPLVGIAFDPRVNPLGARVPAIMGSDIGHWDVPDFSEPLEEAWELVEHGLLDEEQFRDFVFTNQVKLYGVDPDFFRG… |
| A0A7Y5P3B9 | 7-98 | GFYFGCEADDPLVAWAYDNPLGITLKPVLGSDIGHWDVTDMRHVVHEAYELVEHGHLTADRFRAFTCDDPIRLHGRMNPDFFAGTPV… |
| A0A2V7DG80 | 58-150 | None |
| A0A538DMR6 | 182-279 | None |
| A0A7C8CP58 | 82-169 | None |
| A0A523HUE4 | 1-79 | None |
| A0A534UK33 | 125-207 | None |
| A0A679J9G6 | 2-97 | None |
| A0A151XZD6 | 1-68 | None |
| A0A7Y3GV92 | 168-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.