DPCstruct | MC57813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 533 ± 126 aa |
| Standard deviation of domain lengths | 126.44 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.70 |
| Pfam Score | 82.99 |
| Assigned Pfam label(s) | CL0260- CL0036- PF17657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PLG9 | 35-622 | EGVIILSGGTQGDVGKKLLKENVAEIESAVAFYQEFFADHFYLALTRTGKPDEERYIQAALKLAKSHGLPLVATNDVMFLKSDDFEA… |
| A0A1V5KKT9 | 2-498 | YFRTTDDMLREFAYLGKDTASRVVIDAPNRISDMIGEPKLFIPHPEGKETFQPHWDGAEDELREITLRRAREIYGETLPSIVQKRID… |
| A0A4R8EUP3 | 107-857 | None |
| A0A6M0EMX7 | 96-728 | None |
| A0A3N5X9S5 | 13-649 | None |
| A0A3B0B0L2 | 13-712 | None |
| A0A1V2YM49 | 562-1008 | None |
| A0A7Y2DHU4 | 1-415 | None |
| A0A535W2A2 | 114-589 | None |
| A0A829GJ96 | 472-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.