DPCstruct | MC5781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 60 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814H8V6 | 226-269 | IDPIHRSKFGHKNLPYFLIPCQYQQKCVDQRKEHRMKYSHGEKV |
| A0A818TWI8 | 13-59 | EPLHRAQFCHSNLPDYLVPCRYQQNCKTIKVEHRIKYSHREKISLPL |
| A0A814VU00 | 399-450 | None |
| A0A822D5R6 | 9-62 | None |
| A0A820DBR8 | 82-135 | None |
| A0A813YKN2 | 240-310 | None |
| A0A817NE78 | 39-98 | None |
| A0A816B6X7 | 260-318 | None |
| A0A815L246 | 773-854 | None |
| A0A815QY10 | 713-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.