DPCstruct | MC57808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 193 ± 16 aa |
| Standard deviation of domain lengths | 16.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0NW90 | 1-212 | MGRDTGLKEYNALIAVCLEKARTSNDEDDALEHMSEAFKTFKKMRERGFQVEEGTYGPFLMYFIDMGMVEEFFFFCGPIKEGNPSSV… |
| A0A6N2MFE8 | 1-201 | MHGMVFGKLGRETGLKEFNALMKKHIEQCRETDDESVAMKHISAALQLLKSMKEQGFLIGEETYGPFLILLIDKGLVEEFYFFTDFI… |
| A0A0A0L854 | 171-364 | None |
| D7KC77 | 121-304 | None |
| A0A4Y7JFE6 | 28-235 | None |
| A0A2U1LHS0 | 281-446 | None |
| A0A2U1LHR4 | 10-217 | None |
| A0A367GL20 | 176-341 | None |
| A0A2U1KMK9 | 101-305 | None |
| G7JF18 | 122-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.