DPCstruct | MC57805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 64.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1NUR2 | 490-563 | NMKLFGAIPVSDRNFYKLLSRKSHILLYPGGARESFHRKGETCKLFWPEKQEFVRMAVKFGATIIPFGVVGEDD |
| A0A6N2LXI7 | 103-159 | GAVPVTASNLFNLLSAKSHVLLYPGGAREALHNRGEEYKLIWPDQQEFVRMAARFGA |
| A0A7S0GWF7 | 79-154 | None |
| A0A438JCU0 | 68-149 | None |
| D7G6D6 | 5-73 | None |
| A0A2I0KAD0 | 314-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.