DPCstruct | MC57804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 186 |
|---|---|
| Mean domain length (aa) | 71 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 71.79 |
| Assigned Pfam label(s) | CL0010- PF05278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2MAW5 | 10-76 | TAIFSSETPDLAEQLVGSKIKVWWPKDKRFYEGVVDSYDPIKKKHRVLYGDGDEEKLNLNRQRWELI |
| A0A6U9RBR5 | 267-340 | VPDKSLMLKLKDIRKSLVGKQLLLFWPDEGAWYKVEVLELNAKKRIAVVLYDTGESEELELEDIVKNQEIAWNV |
| A0A4S4EKW1 | 553-616 | None |
| A0A4Y7JRM0 | 255-345 | None |
| A0A835A3E3 | 181-257 | None |
| A0A0D2MBA7 | 128-187 | None |
| A0A0D2MHU2 | 15-104 | None |
| A0A5N5HMS1 | 305-382 | None |
| A0A7I8KCC6 | 615-687 | None |
| A0A4Y7LCU9 | 804-876 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.