DPCstruct | MC57803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 48.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A061DXT3 | 42-131 | KRLKTEMEEISEEQKGIRDGQRQVREKFEAIESECEQLKKETKFIIQQSARTQIKLVLMFRILKAREESDSATAANLTQLLGQIVAR… |
| A0A6N2M8X5 | 1-110 | MKRIRADMVKINEGQERIRAGQKEVREKFEEISKDTAKLKEETNTISKQSAANQVRLDLMFQIVKARSENDAPKDAALTQILRALIN… |
| A0A3N7EV77 | 2-91 | None |
| A0A061DJF2 | 37-124 | None |
| A0A061FAZ9 | 25-128 | None |
| A0A4U5P374 | 37-125 | None |
| A0A6N2M7W5 | 1-86 | None |
| A0A1R3KYU3 | 19-128 | None |
| A0A7J9DFA6 | 2-103 | None |
| A0A0D2PR18 | 23-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.