DPCstruct | MC5780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818TMT5 | 7-136 | TTAPRWRRARRGLCLEGQCPTSACEAFNRTVIMSLGFRRFDMLSDVGLATTKCPICKQYVEPVTCSFNNCWWRYEGIKRSQSQAPES… |
| A0A078AI22 | 180-300 | KDDAPWYREISDGLSWICYCQNPKCFAFSQMVVINKGYGVYSINKEMQSIRCPCCLNGKFLEVRNCGFVNCEWAMRGILNKNKESKI… |
| A0A813TW76 | 2-125 | None |
| A0A5J4VUN0 | 22-144 | None |
| A0A388LFB8 | 327-449 | None |
| A0A433QFH2 | 183-305 | None |
| A0A433Q349 | 53-183 | None |
| A0A1V9Y651 | 689-821 | None |
| G4ZCC0 | 44-162 | None |
| A0A814VFZ4 | 15-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.