DPCstruct | MC578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819HST7 | 37-109 | AQAYDFALEKIGMDVYAYTIWNDYVTFLKSVEAVGSYAENQKIAAVRKVYHKGIMIPMISVELLWKDYCSYEM |
| A0A819J3M1 | 1-73 | MAQAYDFALEKIGMDVYSYSIWNDYITFLKSVEAVGSDAENKRMTTVRKIYQKGIMTPMTNVELLWKEYCTYE |
| A0A1S3QXR6 | 31-108 | None |
| K1PMJ9 | 128-203 | None |
| A0A836DAQ8 | 159-230 | None |
| A0A6V7TQ75 | 107-178 | None |
| A0A0N4TAF9 | 1-85 | None |
| E4Y2D8 | 117-192 | None |
| A0A820HNE4 | 1-70 | None |
| A0A5D3C0Q9 | 175-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.