DPCstruct | MC57797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3WV67 | 1-87 | MNSQTTKDIPCFRSYLPDALRLRFEDKLTIRAIAQRLGLSHSTIHTLFQRFLASGIAWPLPDSVSFAQLDAILYANRKKELTEPQIR |
| A0A0E4BXB1 | 1-85 | MPTQRLSMRRIKEVLRLKHFQGLPERAIARSVGVSNGVVHSYLSRARSAGLSWPLPEGMTDEDLELLLFPAPRPASQSPQRPVPD |
| F8CAN8 | 1-81 | None |
| A0A5U9KZ52 | 328-432 | None |
| A0A7Z7N0X0 | 150-221 | None |
| A0A0P8WC77 | 3-78 | None |
| A0A2M7D5J2 | 19-106 | None |
| I6D9U7 | 5-76 | None |
| A0A328TRG1 | 1-77 | None |
| A0A2X2V8D0 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.