DPCstruct | MC57790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8HQ72 | 6-108 | RLSGILRRSLPIRGRLFSAAAEQEHAGAVRTWKILSYVVALPGVAVCMLNVYLKMQHHSHENPEFIPYEHLRIRTKRFPWGDGDKSL… |
| A0A5B7G828 | 1-67 | MVSLLVAMPAIALCMFNAFSAEHEHPPEFVPYEHLRIRTKRFPWGDGNKSLFHNPHVNALPDGYEEH |
| Q6DJA1 | 18-105 | None |
| A0A556UZN1 | 111-214 | None |
| A0A0M3QVJ0 | 14-99 | None |
| G1ST47 | 107-189 | None |
| A0A6P5VKI0 | 128-231 | None |
| A0A6P5VKV1 | 95-194 | None |
| A0A6P8HS29 | 19-119 | None |
| A0A6P5LYI3 | 57-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.