DPCstruct | MC5779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 277 ± 71 aa |
| Standard deviation of domain lengths | 71.15 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 40.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7P8J6 | 27-296 | LSIQEQEEQKQRLLSEQNRLADRGAAEMILLQLAAARGEATAVAQASIELGIAILLDGNVRVQNRMLRYLDEKRLTGFFTSLAGLMQ… |
| A0A818TLK8 | 1-267 | MTRPMKIIDVRAKSSLSDCLANRGAAETVLLYISASENNEMLRRTLQLGISLLHGGNREVQKRMLNYLKEIKDVGCFTLLATLMANC… |
| A0A821QI67 | 87-283 | None |
| A0A819GC02 | 723-927 | None |
| A0A7R9CMK2 | 174-459 | None |
| T1GAN7 | 1-176 | None |
| A0A482SJI0 | 295-694 | None |
| S7P8V3 | 571-840 | None |
| A0A820XHQ8 | 77-336 | None |
| A0A5B7CV44 | 24-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.