DPCstruct | MC5778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443NAW6 | 83-178 | EVEVKLRIPDSAAHQKLSQLLAPFHSKTHLQENVFFDGSESELSSKRAVLRLRFYDGDSLCIVCLKAKAVITDGVSRVEEDEEEIDP… |
| A0A818THF6 | 1-90 | MPRNVEIKARIDDDINDLIERIRPLADGPPRHFTQNDTFFNCPSGGRLKLRIEQDSPAQLIYYERNDVSSLSIPKLSNYLIAPVSHP… |
| B4NU39 | 10-102 | None |
| A0A6H5IBC1 | 602-682 | None |
| A0A4Q3RNP3 | 35-135 | None |
| A0A5N5T9D5 | 156-244 | None |
| A0A660XLP5 | 3-77 | None |
| A0A5B9W6D4 | 127-211 | None |
| A0A7W0T234 | 3-93 | None |
| A0A3B4FVN6 | 67-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.