DPCstruct | MC57779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RM66 | 39-152 | SKENLTESGCNLFDIDPETELQCLEFVSPLLSGDYRLVEINSELADRIMTGEQLVIRGDEEDSPVLCTHDTTYDVKEVTTSNVLLLL… |
| A0A2G9U4L4 | 120-244 | VKAEVQQLQFTEKFPLHDYKLVQLPKEVLNVVKSGDKLVFRGDRQDEVVLCTDSSSYFVKEVETSNSLLIVPTLKTEKDVGDVGAKF… |
| F1LBX7 | 65-188 | None |
| A0A662Y5G7 | 392-532 | None |
| A0A3N4JVA1 | 1-138 | None |
| A0A0M3JPQ5 | 2-99 | None |
| A0A815C0V7 | 22-150 | None |
| A0A6J1ZUK6 | 182-298 | None |
| A0A6V7U3E6 | 13-127 | None |
| A0A1Y2GWQ5 | 12-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.