DPCstruct | MC57776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 203 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RJS9 | 6-219 | YRCGYCNELLGNFDEETLSLCMIALETFVHREPAMAAPLLFRIINTVTRLIEKPLYPWHDTSMFVAGNCRSVAKQLIRVLLHQLSSS… |
| A0A2C9KPK0 | 14-182 | YDDETIGLCIINLATFIHREPGLATPKMLDMLQCAASIASGSQYSWQAESNIIIPGNSVSIARQFLRCVLHQLAPNGIFPMLFQSNM… |
| A0A4C1UQZ5 | 106-333 | None |
| A0A182G1C6 | 552-748 | None |
| A0A444TSD5 | 69-294 | None |
| A0A448XHY7 | 75-283 | None |
| A0A183VEA6 | 1-180 | None |
| A0A182YRS8 | 2-204 | None |
| A0A183JF66 | 176-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.