DPCstruct | MC57770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 176 ± 26 aa |
| Standard deviation of domain lengths | 26.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800IK00 | 2-186 | AQFLFPFWTMPPAGKIEGHVIVRAWVPIDDENTMFWNLSKKRKSGNSPVPISASGRSPSGLSLGFDYLPNTPDWLGRWRLAANQNND… |
| A0A836PV28 | 69-262 | GELEFFERGIQYLGCNTRRVDDHVWVRVNELILPNFTQAGSAFATDGTKTRYFGRSSFTRWVVPVDDNHCIALAWGNFGERGDPMEY… |
| A0A1Q9T7U8 | 82-298 | None |
| A0A1Q4DIU3 | 221-436 | None |
| A0A7C7T2W3 | 198-351 | None |
| A0A126RTM3 | 84-205 | None |
| A0A535B3W8 | 1-165 | None |
| A0A535BDI1 | 7-150 | None |
| A0A370NID4 | 24-222 | None |
| A0A7C3QJA5 | 10-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.