DPCstruct | MC57767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 12.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 12.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9FDL8 | 5-148 | SLYVPFHPARTFFSYLDSDEISLQTDNKGQLVFLQLQLPRASWNVTPKLACPEATVTADIRLVDFREQLPAVTVTATADKSTVRLAF… |
| A0A329WB08 | 6-167 | FYSRLNNKPLSGNLIYRESEYSIDFIDYSPEEMEMLVGSQGCSSLTIGTLQIEVGIETGTLLYPWGLFSLTQCESKVLLQPEMHGGN… |
| A0A1I4FP12 | 9-145 | None |
| A0A350VZ68 | 117-256 | None |
| A0A1R1CPB8 | 1-155 | None |
| A0A4R2KDD7 | 1-149 | None |
| A0A419I5Y2 | 43-206 | None |
| A0A1Z2SL94 | 13-164 | None |
| R6TUK0 | 115-261 | None |
| A0A6P3BB67 | 81-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.