DPCstruct | MC57766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 335 ± 51 aa |
| Standard deviation of domain lengths | 50.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 18.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L6VY57 | 268-524 | GKLFWPTKHAKNSHHLQYPEWLMTGHATALETLKGNGHAQDRCLKCHSAEAYLAKEGTTVTMNDAKLGVTCQVCHASHDPAATKEAF… |
| A0A7X7WJJ8 | 80-422 | NTGWDTNVTNGGYDENHSEALEGVQCEACHGPMGPNPSLAHQPLAEATLSGEACSKCHSTEYTEWRGTSHADTGTAPADLISEWGSS… |
| A0A2J6IZY2 | 40-382 | None |
| A0A2N6DX64 | 195-527 | None |
| A0A317ZI39 | 7-267 | None |
| A0A4Q3IVD5 | 4-348 | None |
| A0A3N5WLV9 | 210-629 | None |
| A0A2N6FKT3 | 195-541 | None |
| A0A399I3C6 | 1-334 | None |
| A0A7X3UH42 | 5-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.