DPCstruct | MC5776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 182 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818QMV9 | 1-180 | MAASDRNILTTTPTSILIDDASALFNKAKSVWSIISKNAATADIHTIHGNVLPANINSPLDLQSWSSSPVSRSSSLTIYSRLGLRVL… |
| A0A7S0ZP28 | 27-200 | SLVCLVSAQVTPSEIIEIGSLLYTAIQDNQPVLDVDKDWGAAVPSGITQWESLANWHDPKQSDSFFVEFKNGVGMKLTKFEWKFAWK… |
| A0A0F6TRF0 | 68-236 | None |
| A0A2M6Y4T2 | 1-165 | None |
| A0A3N8BU24 | 829-970 | None |
| A0A369T6R2 | 677-878 | None |
| A0A1G0AKA5 | 48-263 | None |
| A0A1F3SQ84 | 39-206 | None |
| A0A2D5SAE1 | 1-178 | None |
| A0A2D5SAC0 | 95-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.