DPCstruct | MC57755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 254 ± 39 aa |
| Standard deviation of domain lengths | 38.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P0C875 | 1-284 | MKNVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADP… |
| F7FSA1 | 62-233 | SQSNVIGSQKEVLGPDSVDTAVQSFLYRENYIWKELDKYLQHQELLNLRRQELLHKQWFESVSRPLLSAVSQKIESQSSRDIERRRQ… |
| F7A9Q9 | 33-284 | None |
| F6RME1 | 2-205 | None |
| A0A6J0VPI2 | 28-277 | None |
| A0A6P8IIP1 | 49-342 | None |
| A0A5E4BXY4 | 86-352 | None |
| A0A5N4D8H0 | 1-231 | None |
| A0A287D871 | 2-263 | None |
| A0A6P8R3S1 | 40-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.