DPCstruct | MC57751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 45 ± 4 aa |
| Standard deviation of domain lengths | 3.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6IZ14 | 1-51 | MGHVMTTLNVARVYLRVSTEDQDLQRQEAIIGNARASGYYVAAVYREKASG |
| T0Q7F3 | 1-41 | MKIARIYERVSTSEQDLTRQADIEKTAIASGFYIAGIYGVP |
| A0A1L5NSA8 | 1-48 | None |
| A0A1E5AKY4 | 38-82 | None |
| A0A0H3NPY2 | 3-42 | None |
| A0A7Y1ADA1 | 1-44 | None |
| A0A3M3Q4D3 | 1-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.