DPCstruct | MC5775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0046- PF08990 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1CJF1 | 1-70 | MSNEDRLRHFLKQATAELRQATQRVRELEEADREPIAIVGMACRFPGGVSSPEQLWDVVSGGHDAVSEFP |
| A0A380N7U9 | 1-70 | MPDDNKLVDYLKWVTADLHKTRRRLEEAEAHRREPIAIVGMACRLPGGVDTPEEYWRLLDEGRDGIAPFP |
| X8FCF8 | 1-76 | None |
| A0A6B1MMG9 | 1-57 | None |
| A0A0F4IRL8 | 2-64 | None |
| A0A6B1MQD8 | 5-72 | None |
| A0A4R1CYZ7 | 2-85 | None |
| A0A109SWP7 | 2-77 | None |
| A0A0M8Z5T1 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.