DPCstruct | MC5773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7ZTC9 | 2-127 | IKFMKKELDKVAKFLLDIELTGVENIHRMRVVNQLKKQHEEMVSEEIELLKAHAELDTNGELVRTEAGGFQLKDQDAANEFRTQQEK… |
| A0A7C3UKT1 | 1-159 | MSLSLTYEDLLNIQTGLNKIITLSEKEDSNIEFKIKWRVSRIIKKLNPELQDFSEQRQALLKKLGTEIFTVNKDKVDSDGKPISEST… |
| A0A497RVD1 | 2-190 | None |
| A0A417JWD6 | 1-139 | None |
| A0A6M3L7A8 | 1-89 | None |
| A0A6M3IZE0 | 6-168 | None |
| A0A0F8XNR4 | 25-149 | None |
| A0A350XUK5 | 125-239 | None |
| A0A1C5W1F8 | 1-177 | None |
| A0A842UCL9 | 2-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.