DPCstruct | MC57729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 283 ± 65 aa |
| Standard deviation of domain lengths | 65.09 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842N0Y7 | 8-276 | VELATAVANVPDDVLQQLFIFKNGIKGDGIYGFQDEVFSSTPSQESQYSALNSVIEVTWKIGQKEMIFESVADVIAAEEGGRIEFNE… |
| A0A7V9BFR2 | 2-290 | TLPAFRGKSSRGEVWYIVTESSNRADAARRGVIFAPKLRNALGTGAVQKATLAGDRLSFAGTVDFAPKTVVVPGDQGFPPAKVVPGA… |
| A0A2V8ZW14 | 254-602 | None |
| A0A7V9RCX8 | 65-289 | None |
| A0A399D0A3 | 77-312 | None |
| A0A534HTK4 | 1-198 | None |
| A0A239HPL7 | 40-376 | None |
| D5WR97 | 9-223 | None |
| A0A094I5N2 | 87-456 | None |
| A0A2E9R320 | 586-791 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.