DPCstruct | MC57728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5V5V9 | 103-239 | KADVRDTRLKLPGRATWKRMIRPHSIGAVIGTVEGVTPGAGGTIAAFMSYNEAKRWSRHPEEFGRGSVEGVAAPEAANNVVTATALV… |
| A0A4Q2WI98 | 3-117 | SSLIGTVVGILPGAGGEIASIIAYNETKRWDKDPAKYGKGAIEGVVASESANNAVIGGSLIPLLTLGIPGSAVAAIIMGGLLAHGIA… |
| A0A812T3Q8 | 1046-1163 | None |
| A0A6L5DDP3 | 322-441 | None |
| A0A4V1A2U5 | 70-182 | None |
| A0A4U0R884 | 134-289 | None |
| A0A6N6X7B5 | 7-125 | None |
| A0A853BH35 | 58-225 | None |
| A0A831WN42 | 2-90 | None |
| A0A1Y5T8A4 | 9-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.