DPCstruct | MC5772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 135 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4NNT2 | 4-136 | STYLYRIIDANANRAREGLRTVEEYLRLAQNSTELTFRLKSLRHEITETISKLRIEDQMIQARASDSDVGATDPAGSEAIRTSAGDI… |
| A0A7C3TUN0 | 1-129 | MKKEILRLIDANINRITEGLRVVEEVLRFVYKEDKIYKILRSIRHKIVKLFIEFYPQSVLQRASSIDPGRTAEEKSYKDIRQLIVSN… |
| A0A1F6LN49 | 10-163 | None |
| A0A1G1IMA5 | 3-139 | None |
| A0A3L7TBD5 | 146-288 | None |
| A0A3C0MVC3 | 15-146 | None |
| A0A1W9RMS2 | 11-138 | None |
| A0A1E5IGU3 | 21-161 | None |
| A0A6I5NI24 | 8-134 | None |
| A0A0W0GJH5 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.